SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 387093.SUN_1886 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  387093.SUN_1886
Domain Number 1 Region: 322-517
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.15e-44
Family Ribonuclease PH domain 1-like 0.0000842
Further Details:      
 
Domain Number 2 Region: 7-141
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.01e-35
Family Ribonuclease PH domain 1-like 0.0002
Further Details:      
 
Domain Number 3 Region: 480-574
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.89e-20
Family Ribonuclease PH domain 2-like 0.00017
Further Details:      
 
Domain Number 4 Region: 583-676
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.61e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 5 Region: 647-719
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.29e-16
Family Cold shock DNA-binding domain-like 0.0017
Further Details:      
 
Domain Number 6 Region: 145-250
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 0.0000000000000332
Family Ribonuclease PH domain 2-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 387093.SUN_1886
Sequence length 729
Comment (Sulfurovum NBC37-1)
Sequence
MNEQIIEINLNNLDEKYEFNKIAKQASGAVMYRQGKAVLIAAVAVDEKAVEEDFLPLTVQ
YMERSYAAAKIPGGFIKRETKPGDFETLTSRIVDRSLRPLFPKGFYYPVTISVMVVSSDS
EVDMQVAALHAANAALYVSDISVQRSIAAVRVGKIEDELVLNPTLSQQDESVLDLLVVGS
EQDIIMIEMRAIASEKIDDIEMDMIDPMMGGVPLILEHQECNEVDNEALVDAIAFAAKAI
EEASAIYEKEFTPVMRTPLGLSLAEEKVDEELYAYIKENYSEAVAKAISHMAKSERSTEL
KKVRAQIMEALESEGKEADKELVSKVLDRYKTTVVRDMILDKGIRADGRGLDEVRPITIE
TNILPSVHGSCLFTRGQTQALVTATLGDKKDAQMFELITDKNTQSENFMVHYNFPGYSVG
EAKFIGAPGRRELGHGNLAKRALEPVIPINYDGTIRLVSEVLESNGSSSMATICGGALAL
RAAEVDMVELVAGIAMGLVTDGERVAVLTDIMGLEDHDGDMDFKIAGTRNGITALQMDIK
LGGIDLITLKVALEKAAQGKDHILDLMEEAEKKMESSQALPSTEHFSINPQKIADIIGKA
GATIRDIIEKFEVSIDLDRDKGGVKLSGHDKEKVAAAKEHIEKIANAPVRKQMQYEVGKT
YVGKVKKIVDFGIFVEMPDGFDALLHISKVAKERVNNLNERYHEGDDITVVVMEQKGKKV
ELATPEYLA
Download sequence
Identical sequences A6QBH4
gi|152993469|ref|YP_001359190.1| WP_012083646.1.96465 387093.SUN_1886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]