SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 388396.VFMJ11_2136 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  388396.VFMJ11_2136
Domain Number - Region: 67-111
Classification Level Classification E-value
Superfamily BT0923-like 0.0112
Family BT0923-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 388396.VFMJ11_2136
Sequence length 118
Comment (Vibrio fischeri MJ11)
Sequence
MQFKKWIIALPLAVGLLGGCSLLEPLVYRIDIAQGNYVEQEAVDKLRFGMTKQQVQFVMG
SPMLVESGYPNTWYYIYHFTHGHEKAIQKNLIVHFDDNGNLTNMEGDFPMSDSFFEKL
Download sequence
Identical sequences A0A1B9P4Q2 B5FA16
WP_005420634.1.11820 WP_005420634.1.21686 WP_005420634.1.31530 WP_005420634.1.32349 WP_005420634.1.34024 WP_005420634.1.3463 WP_005420634.1.34959 WP_005420634.1.44395 WP_005420634.1.47877 WP_005420634.1.62330 WP_005420634.1.76599 WP_005420634.1.81434 WP_005420634.1.85856 WP_005420634.1.97281 gi|197335262|ref|YP_002156830.1| 388396.VFMJ11_2136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]