SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 388396.VFMJ11_A0901 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  388396.VFMJ11_A0901
Domain Number 1 Region: 113-187
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 3.53e-23
Family TonB 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 388396.VFMJ11_A0901
Sequence length 201
Comment (Vibrio fischeri MJ11)
Sequence
MALPIAVAISIALFSLMAWMVDNGNQAKPQASEQLSFTMMMVEPESEIQRRQRSVPEQPK
PLEQPPEAKLSQSKSEVSSVMPVTPMSSSGLDTAINGLKISAPTFGSFKTNQQAMPLYRV
EPKYPSRALKRRIEGYVIMSFSIDETGKPFAISVQEAKPKRLFDRDAMRALKQWKYQPKL
VEGKAIIQQNQTVRLEFKLAE
Download sequence
Identical sequences B5EUT1
388396.VFMJ11_A0901 gi|197337766|ref|YP_002158449.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]