SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 390236.BAPKO_0321 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  390236.BAPKO_0321
Domain Number 1 Region: 5-278
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 3.01e-63
Family NAD kinase-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 390236.BAPKO_0321
Sequence length 279
Comment (Borrelia afzelii PKo)
Sequence
MKNKVLLCINTLKSGASILGYDIKVYLETKYFVEVVLIDVGKPLLSFPRENFLFLITLGG
DGTVLLAVNLLLETKNIDIPIISINMGKVGFLADIKIEDFKKVIDRFFNNSLAVNKKFLL
HVTVCQHGKDLISKYALNDIIIRSSILNKMIYVDLRVNSESFLSYKSDGVIVSTPTGSTG
YSFSAGGPILEADLEGFLLTPISPHSVYNRSFVFSKSTKLSLSFSKEYFIASASIFLDGI
NFGSFGVDVVFEFEISSQSLNFVSFCTDTFVKRLKNKLL
Download sequence
Identical sequences Q0SNK0
gi|111115136|ref|YP_709754.1| 390236.BAPKO_0321 gi|111115136|ref|YP_709754.1| WP_004790496.1.101990 WP_004790496.1.4002 WP_004790496.1.72423 WP_004790496.1.79404 WP_004790496.1.94617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]