SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 390236.BAPKO_0532 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  390236.BAPKO_0532
Domain Number 1 Region: 303-460
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.69e-28
Family HD domain 0.017
Further Details:      
 
Domain Number 2 Region: 187-291
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.59e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 390236.BAPKO_0532
Sequence length 509
Comment (Borrelia afzelii PKo)
Sequence
MYIIFSSIFAGFILGFLIRVFLGRLSLLDLEKNLTKVRVESQLEIENERRQIIANAKSQM
LKEKNQQDRDIRDRKNEIVNLEKRLLQREETLDKRISALDKQQSRVDFKIKEFEQKEKVI
REKEADLVKRLENISGLTREDARKIVIEKVEHESRRDAQVIINKSEQEAQLLADKVAKDI
LVSTMQRIVTEVSSEFTVASVELPNDEMKGRIIGKEGRNIRALETLIGADIIIDDTPEAV
VISCFDPIRKELAKRTLERLVTDGRIHPARIEEVVYNVTNEINSIIQEEGEKVVFDLNIH
GLDKRLIRGLGRLYFRSSYGQNVLSHSKETAIIGEILAKEMKLDPIVVKRACLLHDIGKG
MESISDNSEGHAITGAELAQSCGESEIVVNAIAAHHNEVKPESLEAIVVQIADAISASRP
GARRESLNNYINRLKRLEDIAYSFEGVQKCYAIQAGREVRIIVDNALINDEKSILLARDI
AKKIEAEMRYPGKIKVTIIRETRVIEYAR
Download sequence
Identical sequences Q0SN03
gi|111115333|ref|YP_709951.1| gi|111115333|ref|YP_709951.1| 390236.BAPKO_0532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]