SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 390236.BAPKO_0858 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  390236.BAPKO_0858
Domain Number 1 Region: 292-488
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.19e-47
Family Ribonuclease PH domain 1-like 0.0000236
Further Details:      
 
Domain Number 2 Region: 6-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.11e-43
Family Ribonuclease PH domain 1-like 0.0000447
Further Details:      
 
Domain Number 3 Region: 143-227
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.33e-28
Family Ribonuclease PH domain 2-like 0.001
Further Details:      
 
Domain Number 4 Region: 450-546
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.2e-25
Family Ribonuclease PH domain 2-like 0.00016
Further Details:      
 
Domain Number 5 Region: 555-640
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.83e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 6 Region: 618-659,689-715
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000429
Family Cold shock DNA-binding domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 390236.BAPKO_0858
Sequence length 722
Comment (Borrelia afzelii PKo)
Sequence
MRKILKLKIGRDELVFETGFMAKQANGSVLATYGGSSVLATVCCSNNVREDLDFVPLSVE
YNEKYYAAGKIPGGFIKREGKPKDKEILVSRLIDRPMRPLFDKRFGREIQVIPTTLATDQ
LNPPDIVGMNAAFTAVFLSDIPFNGPIAAVRMVYLNGKFIVNPSFEEIHDSDLDIVVAGS
LNGITMVEGGANEVSEDILLSAIDSAHEYIKQICNAQKEFLDIVGEKEKLPLAFEEKIFE
FKEELRDFIYADLKEACFVKGKLNRDKAITLLRNKSYEHFSSLEKLDDSNESLFYKAFDD
FEKEIVRNSILNDKIRTDGRTPNEIRDILAEVDILSRTHGSSLFTRGETQALAVTTLGTS
IDEQIMDDIDGDKRLNFMLHYNFPPFSVGETGRLMTGRREIGHGHLAQRALESMIPGKND
FPYTIRVVSEILESNGSSSMATVCAGSMSLMSAGVPVKRQVAGIAMGLISEGDKYVVLSD
ILGEEDHLGDMDFKVAGTENGITGFQMDIKIENVTKQLMRDALEQARVGRIHILSIMNSV
ISNSRVGISKYAPKIIQLQIDIDKISLVIGSTGKTVKAITDEFEVKVQIEQNGKIILFGD
DDFKMQKAKEKIESIVREPKVGEIYEGTVKKINSFGAFIELTPTKEGFLSTRLKSRDSKY
GSGRFGHGNRYSRFGSGGDNIRGNAGLVRPPKLEEGQRIKVRIVDIDKFGKIDLEIVRDK
DY
Download sequence
Identical sequences Q0SM46
gi|111115640|ref|YP_710258.1| 390236.BAPKO_0858 WP_011601240.1.40725 WP_011601240.1.79404 WP_011601240.1.94617 gi|111115640|ref|YP_710258.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]