SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 390874.Tpet_1177 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  390874.Tpet_1177
Domain Number 1 Region: 66-123
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.0000000000085
Family F1F0 ATP synthase subunit B, membrane domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 390874.Tpet_1177
Sequence length 164
Comment (Thermotoga petrophila RKU-1)
Sequence
MGFLEINWTSAAMLMLFVLMVYFLNKFLYTPFIEMAEKRRKKVEEDLKSAEQLKEEAEKM
RSEAERFLSEARQRADEIVESARKEAEAIVEEAREKAKKEAQNIVESAKTQIEVEYKKAL
EQVQERAAELSVILATKLLQKVFQDERARREYLVKILKEEIEKS
Download sequence
Identical sequences A5ILW8 B1LBC3 G4FG02 Q9X1U9
NP_229414.1.35502 WP_004082072.1.18251 WP_004082072.1.29620 WP_004082072.1.32102 WP_004082072.1.44660 WP_004082072.1.45724 WP_004082072.1.5118 WP_004082072.1.51363 WP_004082072.1.56403 WP_004082072.1.75526 WP_004082072.1.79805 WP_004082072.1.89131 gi|15644362|ref|NP_229414.1| gi|170289066|ref|YP_001739304.1| 126740.TRQ2_1277 243274.TM1614 390874.Tpet_1177 283471 gi|148270307|ref|YP_001244767.1| gi|15644362|ref|NP_229414.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]