SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 391008.Smal_2811 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391008.Smal_2811
Domain Number 1 Region: 303-469
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.57e-47
Family Ribonuclease PH domain 1-like 0.0000187
Further Details:      
 
Domain Number 2 Region: 3-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-46
Family Ribonuclease PH domain 1-like 0.0000158
Further Details:      
 
Domain Number 3 Region: 451-550
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.32e-27
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 4 Region: 144-233
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.23e-27
Family Ribonuclease PH domain 2-like 0.0023
Further Details:      
 
Domain Number 5 Region: 609-695
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.74e-23
Family Cold shock DNA-binding domain-like 0.00022
Further Details:      
 
Domain Number 6 Region: 226-327
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 5.62e-21
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.003
Further Details:      
 
Domain Number 7 Region: 553-630
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.26e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 391008.Smal_2811
Sequence length 702
Comment (Stenotrophomonas maltophilia R551 3)
Sequence
MAKITKTFQYGKHTVTLETGEIARQAGGAVIVKFDDTVLLVSAVAAKSAREGQDFFPLTC
DYQEKFYAGGRIPGGFFKREGRATEKETLISRLIDRPIRPLFPEDYKNEVQIIATVMSLN
PEIDGDIPALIGASAALSLAGTPFKGPIAAAKVGYKDGEYILNPTVSELKESQLELVVAG
TANAVLMVESEAALLSEDVMLGAVTFGHREMQKVINAINELTVEAGTKPSTWEAPAKNTA
LISAVQEAVGPRLGEAFQVRDKLQRRDAISAIKKDVVESLAGRVAAEGWNPAELSKEFGE
LEYSTMRNSVLDTKVRIDGRALDTVRPIAVKTSVLPRTHGSSLFTRGETQAIVTITLGTA
RDGQVIDAVSGEYKENFLFHYNFPPYSVGETGRMMGPKRREIGHGRLAKRGVLAVMPSLE
SFPYTIRVVSEITESNGSSSMASVCGSSLALMDAGVPVKAPVAGIAMGLVKEGDRFVVLS
DILGDEDHLGDMDFKVAGTAEGISALQMDIKIEGITEEIMKQALQQAKAGRLHILGEMAH
GLTAPREELSDYAPRLLTIKIHPDKIREVIGKGGSTIQAITKETGTQIDIQDDGTIVIAS
VNAIAAQAAKARIEQITSDVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSDRV
EKVGDVLKEGDVVKVKVLEVDKQGRIRLSMKAVEEGEGASAE
Download sequence
Identical sequences B4SQR6
gi|194366584|ref|YP_002029194.1| WP_012511700.1.100705 391008.Smal_2811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]