SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 391008.Smal_3308 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391008.Smal_3308
Domain Number 1 Region: 96-103,134-234
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 6.41e-19
Family TonB 0.03
Further Details:      
 
Weak hits

Sequence:  391008.Smal_3308
Domain Number - Region: 52-122
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0811
Family beta-sandwich domain of Sec23/24 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 391008.Smal_3308
Sequence length 239
Comment (Stenotrophomonas maltophilia R551 3)
Sequence
MSGLRRWATSLAIVLLVHALLIGAACWWAARAPALTAAVPPAALMLELAPMAQAPPVPPR
EVATGPLQQQQQRQAPKPALREQPKAPMQPQGELPPPRTPEPTPSPDTADANVAQTSAPP
QVAADAATRYTAPQTTAGERSRAEATWEGRLLGHLQKHRRYPRQAERLRQQGVVYVRFAV
ARDGAVSGLKLGRSSGFALLDQETLDTVQRASPVPAPPAEVAGDPVEVMVPVSFFLRGR
Download sequence
Identical sequences A0A2J0UL36 B4SI43 M5D323
391008.Smal_3308 gi|194367080|ref|YP_002029690.1| WP_006390046.1.100705 WP_006390046.1.52398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]