SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 391009.Tmel_1034 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391009.Tmel_1034
Domain Number 1 Region: 12-83
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 1.26e-29
Family Ribosomal L27 protein 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 391009.Tmel_1034
Sequence length 85
Comment (Thermosipho melanesiensis BI429)
Sequence
MRIDIQLFAKSSTARNGRDSNPKYLGVKKGDGQKVKAGTIIVRQRGTKFWPGKNVGMGRD
FTLFALKDGTVKFEVRNNRKYVSVH
Download sequence
Identical sequences A6LLU4
gi|150020926|ref|YP_001306280.1| 391009.Tmel_1034 WP_012057255.1.25510 WP_012057255.1.29063 WP_012057255.1.34498 WP_012057255.1.43064 WP_012057255.1.53857 WP_012057255.1.82961 WP_012057255.1.85686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]