SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 391037.Sare_1339 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391037.Sare_1339
Domain Number 1 Region: 13-153
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.2e-46
Family Ribonuclease PH domain 1-like 0.000000614
Further Details:      
 
Domain Number 2 Region: 321-517
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.52e-43
Family Ribonuclease PH domain 1-like 0.000000553
Further Details:      
 
Domain Number 3 Region: 154-262
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.05e-27
Family Ribonuclease PH domain 2-like 0.00000696
Further Details:      
 
Domain Number 4 Region: 476-574
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.19e-24
Family Ribonuclease PH domain 2-like 0.0000235
Further Details:      
 
Domain Number 5 Region: 577-684
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.24e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0034
Further Details:      
 
Domain Number 6 Region: 267-346
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.36e-16
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00013
Further Details:      
 
Domain Number 7 Region: 650-721
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000172
Family Cold shock DNA-binding domain-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 391037.Sare_1339
Sequence length 786
Comment (Salinispora arenicola CNS-205)
Sequence
MTESNLGAQSRTATIDNGAFGTRVITFSTGRLARQAAGSVVAQLGETVVLSATTVGRQPK
EQFDFFPLTVDVEERMYAAGRIPGSFFRREGRPSEDAILTCRLIDRPLRPSFVKGLRNEV
QVVETVLALDPSHPYDVVAINAASMSTKLSGLPFSGPIGATRMAHIDGSWVAFPTHEELE
RATFDMVVAGRALPDGDVAIMMVEAEATEHTVKLVAGGASAPTEEVVASGLEAAKPAIRE
LCRAQSELAEVAAKPVAEFPVFLDYSDDAYQAVADLARSDVAEALKIAGKADREEALDRI
KARVIEDLGPRFEGREKELSAALRSLTKSEVRSRVLREQVRIDGRGPRDIRPLTAEVGVL
PRVHGSALFERGETQILGVTTLNMLRMEQSLDTLSPEKSKRYMHNYNFPPYSTGETGRVG
SPKRREIGHGALAERALIPVLPSREEFPYAIRQVSEALGSNGSTSMGSVCASTLGLLSAG
VPLKAPVAGIAMGLISDEVEGKTRYVTLTDILGAEDAFGDMDFKVAGTQEFVTALQLDTK
LDGIPSDVLAAALQQAYEARQTILEVMQAAIEAPATMSDYAPRVTTVKIPVDKIGMVIGP
KGQTINAIQDETGAEISIEDDGTIYVGATNGPSAQAAVERVNAIANPTLPKVGDRFLGTV
VKTAAFGAFVSLLPGRDGLLHISKVGDGKRVEKVEDYLNVGDKVEVEIADIDQRGKIYLD
KVRPEGAEGPAEAAATDRPAGRDRGDRAPRDRGDRGDRERGSRGPDRGDGGEGGGESRPR
RRTRHS
Download sequence
Identical sequences A8M758
391037.Sare_1339 gi|159036978|ref|YP_001536231.1| WP_012181548.1.33355 WP_012181548.1.69805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]