SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 391038.Bphy_6979 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391038.Bphy_6979
Domain Number 1 Region: 3-189
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.02e-43
Family FAD/NAD-linked reductases, N-terminal and central domains 0.001
Further Details:      
 
Domain Number 2 Region: 316-407
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.17e-30
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00054
Further Details:      
 
Domain Number 3 Region: 142-315
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.02e-29
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 391038.Bphy_6979
Sequence length 418
Comment (Burkholderia phymatum STM815)
Sequence
MKRTLVIVGASYAGVQLAACARELGFDGRILLLGDEPDAPYQRPPLSKGFLTGSFAEERL
PLRSQAFFDEEKIERMLATRASRIDRERREIELHDGSRIAYDQLALTTGARVRKLDCPGA
TLDAVHYLRDLRDARRLAASARSARRAVVVGGGYIGLEAASSLRQQGLDVTVVETEPRLL
ARVASPWVSDFMLRAHVERGVAFELGRKVVALHDACGIVSVELDDGTRVLCDLVVVGIGV
IPNTELAANCGLHANGGIIVDACARTSDPLIVAAGDCASFVPHWAPPDTRACRIESVQNA
NDMARTAASSVLGRSEPYRAVPWFWSDQYDLKLQMAGVNAGFTDFAVRGCADDRKCSLFY
FRDKTLIAVDSINRPQDHMLARKLLASGVQVSADEVRNPAFDLKALASRDSHAAQGVA
Download sequence
Identical sequences B2JTT2
WP_012406141.1.55900 gi|186471713|ref|YP_001863031.1| gi|186471713|ref|YP_001863031.1|NC_010625 391038.Bphy_6979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]