SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 391165.GbCGDNIH1_2351 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391165.GbCGDNIH1_2351
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.06e-53
Family Ribonuclease PH domain 1-like 0.0000186
Further Details:      
 
Domain Number 2 Region: 291-488
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.64e-50
Family Ribonuclease PH domain 1-like 0.0000135
Further Details:      
 
Domain Number 3 Region: 138-230
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.37e-27
Family Ribonuclease PH domain 2-like 0.0017
Further Details:      
 
Domain Number 4 Region: 450-544
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.38e-26
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 5 Region: 555-640
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.21e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 6 Region: 620-702
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.79e-20
Family Cold shock DNA-binding domain-like 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 391165.GbCGDNIH1_2351
Sequence length 720
Comment (Granulobacter bethesdensis CGDNIH1)
Sequence
MFNYFRKELDLGGRTLVLETGKIARQADGAVLARLGDTIVLCTAVGAKSAKAGQDFFPLT
VNYQEKAFAAGKIPGGFFKREGRPSEHETLVSRLIDRPIRPLFPEGFYNEVQVIATVLSH
DMENDPDIVALIGCSAALTLSGIPFFGPVAASRVGLVNGAFVLNPTLEQRAESKLDLVVA
GTAEGVLMVESEAEELSEDQMLAAVEFGHKGFQPVIDAIIALAEHAARDPWTLPEQNPEH
VALKQRLNEAGRTLLGNAYQEKVKQLRQEKISAAKKQIIETLGIGGTPEESIAKSMLKDL
EADIVRNAILDTGIRIDGRDTRTVRPIIGEVGILPRAHGSALFTRGETQALCVATLGTGQ
DEQVVDALTGEYRSHFMLHYNFPPYSVGEAGRMGSPGRREIGHGKLAWRAVHPVLPAKDA
FPYTLRVVSEITESNGSSSMATVCGSSLALMDAGVPLKRPVAGIAMGLIKEDRAFAVLSD
ILGDEDHLGDMDFKVAGTEQGVTSLQMDIKITSITTEIMRIALQQARDGRMHILGEMAKA
ITGARGSVAATAPRITVINVPKEKIREVIGTGGKVIREIVEFSGAKIDIEDDGTIKIAST
SEESTQKAIDRIQGIVAEPEVGKIYNGKVVKTADFGAFVNFLGSRDGLVHISELQQGRVN
KTSDVINVGDVVKVKVLGFDDRGKVKLSMRLVDQTTGEDISDKVGPKGGRGGRGEGDLAE
Download sequence
Identical sequences Q0BPK3
gi|114329015|ref|YP_746172.1| 391165.GbCGDNIH1_2351 WP_011633051.1.12764 WP_011633051.1.23923 WP_011633051.1.39002 WP_011633051.1.65638 WP_011633051.1.72603 WP_011633051.1.90404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]