SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 391295.SSU05_0421 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391295.SSU05_0421
Domain Number 1 Region: 337-491
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.59e-29
Family HD domain 0.019
Further Details:      
 
Domain Number 2 Region: 225-321
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000198
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 391295.SSU05_0421
Sequence length 537
Comment (Streptococcus suis 05ZYH33)
Sequence
MNIITVVVTLVSALIGLVLGYFAISLKMKSAKETAELTLLNAEQEASNVRGRAEEQAEVI
LKTAERDRQTLKKELLLEAKEEARKYREEIAEEFKSERQELKQIESRLTERATSLDRKDD
NLTNKEKTLEQKEQSLTDKAKHIDEREQEVVKLEEQKALELERVAALSQEEAKEIILTDT
RDKLTHEIATRIKEAEREVKERSDKMAKDLLAQAMQRISGEYVAEQTITSVHLPDDAMKG
RIIGREGRNIRTFESLTGIDVIIDDTPEVVVLSGFDPIRREIARMTMETLLQDGRIHPAR
IEELVEKHRVEMDNRIREYGEAAAYEVGAPNLHPDLIKIMGRLHFRTSYGQNVLRHSIEV
AKLAGVLAAELGENVNLARRAGFLHDVGKAIDREVDGSHVEIGTELAKKYKENPIVINAI
ASHHGDVEATSTIAVIVAAADALSAARPGSRRESMEAYIKRLQDLEEIANSFEGIKQSYA
IQAGREIRIIVHPNKVTDDQITILAHDVREKIENNLDYPGNIKITVIRETRATDVAK
Download sequence
Identical sequences A0A075SHL5 A0A0H3MTT7 A0A0N0DNT7 A4VTE9 A4VZM7 D5AG74 G7SJZ4 U5UDN7
218494.SSU0377 391295.SSU05_0421 391296.SSU98_0408 568813.SSUSC84_0363 568814.SSUBM407_0366 gi|146320255|ref|YP_001199966.1| gi|389856105|ref|YP_006358348.1| gi|253751269|ref|YP_003024410.1| gi|556588005|ref|YP_008755559.1| gi|403061062|ref|YP_006649278.1| gi|386577376|ref|YP_006073781.1| gi|386581421|ref|YP_006077825.1| WP_011921986.1.10007 WP_011921986.1.100280 WP_011921986.1.100404 WP_011921986.1.100490 WP_011921986.1.100670 WP_011921986.1.100701 WP_011921986.1.100904 WP_011921986.1.100908 WP_011921986.1.101097 WP_011921986.1.101179 WP_011921986.1.101295 WP_011921986.1.101447 WP_011921986.1.101621 WP_011921986.1.101658 WP_011921986.1.101706 WP_011921986.1.101901 WP_011921986.1.102003 WP_011921986.1.102038 WP_011921986.1.10265 WP_011921986.1.10700 WP_011921986.1.10896 WP_011921986.1.10904 WP_011921986.1.11017 WP_011921986.1.11330 WP_011921986.1.11527 WP_011921986.1.11548 WP_011921986.1.11662 WP_011921986.1.11869 WP_011921986.1.11874 WP_011921986.1.11918 WP_011921986.1.1200 WP_011921986.1.12022 WP_011921986.1.12228 WP_011921986.1.12288 WP_011921986.1.1244 WP_011921986.1.12606 WP_011921986.1.12803 WP_011921986.1.12908 WP_011921986.1.13051 WP_011921986.1.13095 WP_011921986.1.13153 WP_011921986.1.1324 WP_011921986.1.13380 WP_011921986.1.13633 WP_011921986.1.13861 WP_011921986.1.1405 WP_011921986.1.14202 WP_011921986.1.14210 WP_011921986.1.1424 WP_011921986.1.1434 WP_011921986.1.14359 WP_011921986.1.14903 WP_011921986.1.1495 WP_011921986.1.15035 WP_011921986.1.15112 WP_011921986.1.1537 WP_011921986.1.15393 WP_011921986.1.15545 WP_011921986.1.15756 WP_011921986.1.15813 WP_011921986.1.1608 WP_011921986.1.1616 WP_011921986.1.16193 WP_011921986.1.16255 WP_011921986.1.16271 WP_011921986.1.1629 WP_011921986.1.16498 WP_011921986.1.16643 WP_011921986.1.16677 WP_011921986.1.16683 WP_011921986.1.16773 WP_011921986.1.16829 WP_011921986.1.16881 WP_011921986.1.17264 WP_011921986.1.17388 WP_011921986.1.17549 WP_011921986.1.17670 WP_011921986.1.17730 WP_011921986.1.17749 WP_011921986.1.17814 WP_011921986.1.17824 WP_011921986.1.17958 WP_011921986.1.17989 WP_011921986.1.18076 WP_011921986.1.18271 WP_011921986.1.18341 WP_011921986.1.18403 WP_011921986.1.18563 WP_011921986.1.18711 WP_011921986.1.18850 WP_011921986.1.19145 WP_011921986.1.19352 WP_011921986.1.19378 WP_011921986.1.19521 WP_011921986.1.1953 WP_011921986.1.19757 WP_011921986.1.19865 WP_011921986.1.19898 WP_011921986.1.1991 WP_011921986.1.20400 WP_011921986.1.20518 WP_011921986.1.20584 WP_011921986.1.20756 WP_011921986.1.20792 WP_011921986.1.20819 WP_011921986.1.20944 WP_011921986.1.20963 WP_011921986.1.21072 WP_011921986.1.21347 WP_011921986.1.21348 WP_011921986.1.21374 WP_011921986.1.21457 WP_011921986.1.21903 WP_011921986.1.21994 WP_011921986.1.22347 WP_011921986.1.22560 WP_011921986.1.22785 WP_011921986.1.22805 WP_011921986.1.22848 WP_011921986.1.22882 WP_011921986.1.23089 WP_011921986.1.23273 WP_011921986.1.23317 WP_011921986.1.23358 WP_011921986.1.23682 WP_011921986.1.23965 WP_011921986.1.24078 WP_011921986.1.24086 WP_011921986.1.24150 WP_011921986.1.24175 WP_011921986.1.24187 WP_011921986.1.24431 WP_011921986.1.24858 WP_011921986.1.24883 WP_011921986.1.25245 WP_011921986.1.25280 WP_011921986.1.25381 WP_011921986.1.25396 WP_011921986.1.25617 WP_011921986.1.25711 WP_011921986.1.25798 WP_011921986.1.25824 WP_011921986.1.25841 WP_011921986.1.25950 WP_011921986.1.26009 WP_011921986.1.26302 WP_011921986.1.26368 WP_011921986.1.26507 WP_011921986.1.26620 WP_011921986.1.27108 WP_011921986.1.27225 WP_011921986.1.27227 WP_011921986.1.27381 WP_011921986.1.27476 WP_011921986.1.27695 WP_011921986.1.27754 WP_011921986.1.27760 WP_011921986.1.27767 WP_011921986.1.28000 WP_011921986.1.28033 WP_011921986.1.28467 WP_011921986.1.28645 WP_011921986.1.28796 WP_011921986.1.28805 WP_011921986.1.28908 WP_011921986.1.29141 WP_011921986.1.29299 WP_011921986.1.29542 WP_011921986.1.29545 WP_011921986.1.29610 WP_011921986.1.29635 WP_011921986.1.30079 WP_011921986.1.30136 WP_011921986.1.30241 WP_011921986.1.30344 WP_011921986.1.30414 WP_011921986.1.30562 WP_011921986.1.30785 WP_011921986.1.31254 WP_011921986.1.31418 WP_011921986.1.31425 WP_011921986.1.31597 WP_011921986.1.31707 WP_011921986.1.31730 WP_011921986.1.31763 WP_011921986.1.32048 WP_011921986.1.32213 WP_011921986.1.32258 WP_011921986.1.32259 WP_011921986.1.32292 WP_011921986.1.32332 WP_011921986.1.32380 WP_011921986.1.32466 WP_011921986.1.32630 WP_011921986.1.32947 WP_011921986.1.33330 WP_011921986.1.33353 WP_011921986.1.33471 WP_011921986.1.33494 WP_011921986.1.34321 WP_011921986.1.34425 WP_011921986.1.34527 WP_011921986.1.34652 WP_011921986.1.34738 WP_011921986.1.35430 WP_011921986.1.35551 WP_011921986.1.35675 WP_011921986.1.35725 WP_011921986.1.35749 WP_011921986.1.36136 WP_011921986.1.36251 WP_011921986.1.36341 WP_011921986.1.36365 WP_011921986.1.36437 WP_011921986.1.36611 WP_011921986.1.36766 WP_011921986.1.36945 WP_011921986.1.37126 WP_011921986.1.37237 WP_011921986.1.376 WP_011921986.1.37653 WP_011921986.1.37688 WP_011921986.1.37816 WP_011921986.1.37841 WP_011921986.1.37914 WP_011921986.1.37915 WP_011921986.1.38285 WP_011921986.1.38409 WP_011921986.1.38470 WP_011921986.1.39011 WP_011921986.1.39023 WP_011921986.1.39247 WP_011921986.1.39263 WP_011921986.1.39280 WP_011921986.1.3989 WP_011921986.1.40062 WP_011921986.1.40141 WP_011921986.1.40169 WP_011921986.1.40228 WP_011921986.1.40265 WP_011921986.1.40384 WP_011921986.1.40507 WP_011921986.1.40669 WP_011921986.1.4074 WP_011921986.1.40802 WP_011921986.1.41046 WP_011921986.1.41052 WP_011921986.1.41112 WP_011921986.1.41280 WP_011921986.1.41340 WP_011921986.1.41854 WP_011921986.1.42323 WP_011921986.1.42552 WP_011921986.1.42596 WP_011921986.1.42732 WP_011921986.1.42735 WP_011921986.1.4278 WP_011921986.1.42784 WP_011921986.1.42827 WP_011921986.1.42840 WP_011921986.1.4291 WP_011921986.1.43264 WP_011921986.1.43288 WP_011921986.1.43482 WP_011921986.1.43813 WP_011921986.1.43922 WP_011921986.1.43963 WP_011921986.1.43977 WP_011921986.1.44047 WP_011921986.1.44128 WP_011921986.1.44134 WP_011921986.1.44592 WP_011921986.1.44612 WP_011921986.1.44676 WP_011921986.1.44778 WP_011921986.1.45088 WP_011921986.1.45216 WP_011921986.1.45219 WP_011921986.1.45278 WP_011921986.1.4529 WP_011921986.1.45345 WP_011921986.1.45864 WP_011921986.1.45936 WP_011921986.1.467 WP_011921986.1.46880 WP_011921986.1.47108 WP_011921986.1.47119 WP_011921986.1.47315 WP_011921986.1.47375 WP_011921986.1.47434 WP_011921986.1.4748 WP_011921986.1.4757 WP_011921986.1.47643 WP_011921986.1.47745 WP_011921986.1.47869 WP_011921986.1.47894 WP_011921986.1.47900 WP_011921986.1.48076 WP_011921986.1.48167 WP_011921986.1.48217 WP_011921986.1.48397 WP_011921986.1.48583 WP_011921986.1.49093 WP_011921986.1.49099 WP_011921986.1.49206 WP_011921986.1.49255 WP_011921986.1.49368 WP_011921986.1.49413 WP_011921986.1.49509 WP_011921986.1.49782 WP_011921986.1.49968 WP_011921986.1.50047 WP_011921986.1.50127 WP_011921986.1.5021 WP_011921986.1.50437 WP_011921986.1.50538 WP_011921986.1.50551 WP_011921986.1.50635 WP_011921986.1.50675 WP_011921986.1.50751 WP_011921986.1.5079 WP_011921986.1.50798 WP_011921986.1.51052 WP_011921986.1.51155 WP_011921986.1.51263 WP_011921986.1.51386 WP_011921986.1.51551 WP_011921986.1.52159 WP_011921986.1.52175 WP_011921986.1.52490 WP_011921986.1.52599 WP_011921986.1.52628 WP_011921986.1.52798 WP_011921986.1.53030 WP_011921986.1.53174 WP_011921986.1.53290 WP_011921986.1.53309 WP_011921986.1.53344 WP_011921986.1.53448 WP_011921986.1.53487 WP_011921986.1.53749 WP_011921986.1.53805 WP_011921986.1.53918 WP_011921986.1.54000 WP_011921986.1.5404 WP_011921986.1.54184 WP_011921986.1.54343 WP_011921986.1.54384 WP_011921986.1.54488 WP_011921986.1.54535 WP_011921986.1.54683 WP_011921986.1.54800 WP_011921986.1.54828 WP_011921986.1.55064 WP_011921986.1.5509 WP_011921986.1.55137 WP_011921986.1.55158 WP_011921986.1.55649 WP_011921986.1.55687 WP_011921986.1.5579 WP_011921986.1.55815 WP_011921986.1.55833 WP_011921986.1.55834 WP_011921986.1.55864 WP_011921986.1.56077 WP_011921986.1.56140 WP_011921986.1.56150 WP_011921986.1.56215 WP_011921986.1.56434 WP_011921986.1.56463 WP_011921986.1.57067 WP_011921986.1.5714 WP_011921986.1.57164 WP_011921986.1.57189 WP_011921986.1.5754 WP_011921986.1.57640 WP_011921986.1.57674 WP_011921986.1.57810 WP_011921986.1.58229 WP_011921986.1.58517 WP_011921986.1.58566 WP_011921986.1.58585 WP_011921986.1.58746 WP_011921986.1.58793 WP_011921986.1.58815 WP_011921986.1.58903 WP_011921986.1.58933 WP_011921986.1.5894 WP_011921986.1.59071 WP_011921986.1.59138 WP_011921986.1.59144 WP_011921986.1.59283 WP_011921986.1.59349 WP_011921986.1.5936 WP_011921986.1.59524 WP_011921986.1.59647 WP_011921986.1.5974 WP_011921986.1.59929 WP_011921986.1.60184 WP_011921986.1.60233 WP_011921986.1.60237 WP_011921986.1.60293 WP_011921986.1.60377 WP_011921986.1.60445 WP_011921986.1.60658 WP_011921986.1.60659 WP_011921986.1.6071 WP_011921986.1.60853 WP_011921986.1.609 WP_011921986.1.61370 WP_011921986.1.61415 WP_011921986.1.61533 WP_011921986.1.61540 WP_011921986.1.6156 WP_011921986.1.6165 WP_011921986.1.61715 WP_011921986.1.61782 WP_011921986.1.6223 WP_011921986.1.62268 WP_011921986.1.62485 WP_011921986.1.62497 WP_011921986.1.62587 WP_011921986.1.62710 WP_011921986.1.6272 WP_011921986.1.6278 WP_011921986.1.62805 WP_011921986.1.63018 WP_011921986.1.63174 WP_011921986.1.63318 WP_011921986.1.63653 WP_011921986.1.63685 WP_011921986.1.63959 WP_011921986.1.64009 WP_011921986.1.64120 WP_011921986.1.64128 WP_011921986.1.64273 WP_011921986.1.64281 WP_011921986.1.64384 WP_011921986.1.64641 WP_011921986.1.64797 WP_011921986.1.64952 WP_011921986.1.64997 WP_011921986.1.65024 WP_011921986.1.65047 WP_011921986.1.65161 WP_011921986.1.65174 WP_011921986.1.65184 WP_011921986.1.65314 WP_011921986.1.65422 WP_011921986.1.65458 WP_011921986.1.65905 WP_011921986.1.65911 WP_011921986.1.6596 WP_011921986.1.66185 WP_011921986.1.66186 WP_011921986.1.66300 WP_011921986.1.66472 WP_011921986.1.66521 WP_011921986.1.66590 WP_011921986.1.66609 WP_011921986.1.66707 WP_011921986.1.6686 WP_011921986.1.6690 WP_011921986.1.66954 WP_011921986.1.67058 WP_011921986.1.67109 WP_011921986.1.6711 WP_011921986.1.67256 WP_011921986.1.67338 WP_011921986.1.67488 WP_011921986.1.6758 WP_011921986.1.677 WP_011921986.1.67883 WP_011921986.1.67897 WP_011921986.1.67958 WP_011921986.1.67962 WP_011921986.1.68010 WP_011921986.1.68303 WP_011921986.1.68602 WP_011921986.1.68666 WP_011921986.1.68739 WP_011921986.1.68791 WP_011921986.1.68941 WP_011921986.1.69056 WP_011921986.1.69115 WP_011921986.1.69161 WP_011921986.1.69413 WP_011921986.1.69454 WP_011921986.1.6967 WP_011921986.1.69698 WP_011921986.1.69706 WP_011921986.1.69922 WP_011921986.1.70033 WP_011921986.1.70102 WP_011921986.1.70387 WP_011921986.1.70403 WP_011921986.1.70484 WP_011921986.1.70817 WP_011921986.1.70832 WP_011921986.1.70997 WP_011921986.1.71125 WP_011921986.1.71140 WP_011921986.1.71425 WP_011921986.1.71432 WP_011921986.1.71462 WP_011921986.1.71498 WP_011921986.1.71727 WP_011921986.1.718 WP_011921986.1.71914 WP_011921986.1.72174 WP_011921986.1.72185 WP_011921986.1.72247 WP_011921986.1.72296 WP_011921986.1.72413 WP_011921986.1.7257 WP_011921986.1.72611 WP_011921986.1.72924 WP_011921986.1.73011 WP_011921986.1.73262 WP_011921986.1.73280 WP_011921986.1.7342 WP_011921986.1.73679 WP_011921986.1.73721 WP_011921986.1.73905 WP_011921986.1.74090 WP_011921986.1.74132 WP_011921986.1.74368 WP_011921986.1.74554 WP_011921986.1.74567 WP_011921986.1.74800 WP_011921986.1.74843 WP_011921986.1.74865 WP_011921986.1.75022 WP_011921986.1.75028 WP_011921986.1.75605 WP_011921986.1.75643 WP_011921986.1.75930 WP_011921986.1.75965 WP_011921986.1.75985 WP_011921986.1.76083 WP_011921986.1.76175 WP_011921986.1.76400 WP_011921986.1.76666 WP_011921986.1.76735 WP_011921986.1.76811 WP_011921986.1.76907 WP_011921986.1.77006 WP_011921986.1.77026 WP_011921986.1.7754 WP_011921986.1.77616 WP_011921986.1.77624 WP_011921986.1.7763 WP_011921986.1.77781 WP_011921986.1.77795 WP_011921986.1.77958 WP_011921986.1.78326 WP_011921986.1.78456 WP_011921986.1.7873 WP_011921986.1.78744 WP_011921986.1.78792 WP_011921986.1.7889 WP_011921986.1.78945 WP_011921986.1.79054 WP_011921986.1.79154 WP_011921986.1.79162 WP_011921986.1.79499 WP_011921986.1.79610 WP_011921986.1.79644 WP_011921986.1.79679 WP_011921986.1.80097 WP_011921986.1.80131 WP_011921986.1.80153 WP_011921986.1.80169 WP_011921986.1.80235 WP_011921986.1.80418 WP_011921986.1.8061 WP_011921986.1.80716 WP_011921986.1.80787 WP_011921986.1.8083 WP_011921986.1.81103 WP_011921986.1.81370 WP_011921986.1.81513 WP_011921986.1.81584 WP_011921986.1.81705 WP_011921986.1.82122 WP_011921986.1.82418 WP_011921986.1.8251 WP_011921986.1.82830 WP_011921986.1.82870 WP_011921986.1.82977 WP_011921986.1.83087 WP_011921986.1.83279 WP_011921986.1.8344 WP_011921986.1.83818 WP_011921986.1.83915 WP_011921986.1.84389 WP_011921986.1.84412 WP_011921986.1.84489 WP_011921986.1.8451 WP_011921986.1.84535 WP_011921986.1.85051 WP_011921986.1.85075 WP_011921986.1.8514 WP_011921986.1.85327 WP_011921986.1.85437 WP_011921986.1.85450 WP_011921986.1.85908 WP_011921986.1.86151 WP_011921986.1.86177 WP_011921986.1.86817 WP_011921986.1.86836 WP_011921986.1.86842 WP_011921986.1.87044 WP_011921986.1.87321 WP_011921986.1.87344 WP_011921986.1.87438 WP_011921986.1.87450 WP_011921986.1.87819 WP_011921986.1.87874 WP_011921986.1.87885 WP_011921986.1.8790 WP_011921986.1.88201 WP_011921986.1.88543 WP_011921986.1.88575 WP_011921986.1.88635 WP_011921986.1.88653 WP_011921986.1.88746 WP_011921986.1.88779 WP_011921986.1.88882 WP_011921986.1.88972 WP_011921986.1.89037 WP_011921986.1.89038 WP_011921986.1.89056 WP_011921986.1.89128 WP_011921986.1.89156 WP_011921986.1.89279 WP_011921986.1.89358 WP_011921986.1.89388 WP_011921986.1.89800 WP_011921986.1.8993 WP_011921986.1.89981 WP_011921986.1.89989 WP_011921986.1.90172 WP_011921986.1.90419 WP_011921986.1.90742 WP_011921986.1.90961 WP_011921986.1.91238 WP_011921986.1.91387 WP_011921986.1.91636 WP_011921986.1.91792 WP_011921986.1.91865 WP_011921986.1.91912 WP_011921986.1.91973 WP_011921986.1.91983 WP_011921986.1.92134 WP_011921986.1.92263 WP_011921986.1.92441 WP_011921986.1.92554 WP_011921986.1.92692 WP_011921986.1.92722 WP_011921986.1.928 WP_011921986.1.92964 WP_011921986.1.93190 WP_011921986.1.93220 WP_011921986.1.93456 WP_011921986.1.93510 WP_011921986.1.93519 WP_011921986.1.9361 WP_011921986.1.93627 WP_011921986.1.93646 WP_011921986.1.9376 WP_011921986.1.93771 WP_011921986.1.94338 WP_011921986.1.94418 WP_011921986.1.94419 WP_011921986.1.94449 WP_011921986.1.9454 WP_011921986.1.94587 WP_011921986.1.94639 WP_011921986.1.94661 WP_011921986.1.94780 WP_011921986.1.94786 WP_011921986.1.94945 WP_011921986.1.95180 WP_011921986.1.95213 WP_011921986.1.95214 WP_011921986.1.95262 WP_011921986.1.95288 WP_011921986.1.95351 WP_011921986.1.95542 WP_011921986.1.95788 WP_011921986.1.95798 WP_011921986.1.96164 WP_011921986.1.96282 WP_011921986.1.96427 WP_011921986.1.96451 WP_011921986.1.9652 WP_011921986.1.96524 WP_011921986.1.96574 WP_011921986.1.96700 WP_011921986.1.96973 WP_011921986.1.97052 WP_011921986.1.97453 WP_011921986.1.97493 WP_011921986.1.97504 WP_011921986.1.97515 WP_011921986.1.97554 WP_011921986.1.97722 WP_011921986.1.97857 WP_011921986.1.9809 WP_011921986.1.9815 WP_011921986.1.98253 WP_011921986.1.98326 WP_011921986.1.98343 WP_011921986.1.98406 WP_011921986.1.98416 WP_011921986.1.98464 WP_011921986.1.98860 WP_011921986.1.98864 WP_011921986.1.98889 WP_011921986.1.98921 WP_011921986.1.99127 WP_011921986.1.9922 WP_011921986.1.99252 WP_011921986.1.99324 WP_011921986.1.9956 WP_011921986.1.99696 WP_011921986.1.99988 YP_003028133.1.79686 gi|253753170|ref|YP_003026310.1| gi|476419361|ref|YP_007570357.1| gi|253754993|ref|YP_003028133.1| gi|386587652|ref|YP_006084053.1| gi|386579357|ref|YP_006075762.1| gi|146318076|ref|YP_001197788.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]