SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 391296.SSU98_0087 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391296.SSU98_0087
Domain Number 1 Region: 10-119
Classification Level Classification E-value
Superfamily Translational machinery components 9.35e-53
Family Ribosomal protein L18 and S11 0.0000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 391296.SSU98_0087
Sequence length 121
Comment (Streptococcus suis 98HAH33)
Sequence
MNIVISKPDKNKIRQKRHRRVRGKISGTAARPRLNIFRSNTGIYAQVIDDVAGVTLASAS
TLDKEVSKGTKTEQAVVVGKLVAERAVAKGISEVVFDRGGYLYHGRVKALAESARENGLK
F
Download sequence
Identical sequences A0A126UJ67 A4VSG9 A4VYQ8 D5AFD4
gi|386577086|ref|YP_006073491.1| gi|146319936|ref|YP_001199647.1| gi|476419091|ref|YP_007570087.1| gi|146317746|ref|YP_001197458.1| 391295.SSU05_0086 391296.SSU98_0087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]