SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 391296.SSU98_1932 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391296.SSU98_1932
Domain Number 1 Region: 58-194
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.57e-45
Family Ribonuclease PH domain 1-like 0.0000301
Further Details:      
 
Domain Number 2 Region: 355-547
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.53e-42
Family Ribonuclease PH domain 1-like 0.0000112
Further Details:      
 
Domain Number 3 Region: 505-602
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.3e-28
Family Ribonuclease PH domain 2-like 0.0000925
Further Details:      
 
Domain Number 4 Region: 195-285
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.15e-28
Family Ribonuclease PH domain 2-like 0.0022
Further Details:      
 
Domain Number 5 Region: 667-750
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.77e-21
Family Cold shock DNA-binding domain-like 0.0016
Further Details:      
 
Domain Number 6 Region: 611-695
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.09e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 7 Region: 288-375
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000000000000471
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 391296.SSU98_1932
Sequence length 791
Comment (Streptococcus suis 98HAH33)
Sequence
MSKIVSGLYFYLKYDKIRSMRGFVPKRVKQACLIVFCRKHARKISRKNRRQLMSKQVFET
VFAGKKLVVETGQVAKQANGAVVVRYGDSTVLTAAVMSKKMATGDFFPLQVNYEEKMYAA
GKFPGGWMKREGRPSTDATLTARLIDRPIRPMFAEGFRNEVQVINTVLSYDPDASAPMAA
MFGSSLALAISDIPFNGPIAGVQVGYVNGELIINPDQAQQEASLLELTVAGNKDAINMVE
SGAKELSEEVMLEALLKGHAAIQELLDFQNQIVAAVGKEKADVELLQVDPELQAEIVAAY
NDDLKKAVQVEEKLAREDATNAVRETVIATYEEKYAEHEEFDRIMRDVHEILELMEHTEV
RRLITEDKVRPDGRRVDEIRPLDAEVDFLPNVHGSGLFTRGQTQALSVLTLAPMGETQII
DGLDDEYKKRFLHHYNFPQYSVGSTGRYGAPGRREIGHGALGERALEQVLPSLEDFPYAI
RLVAEVLESNGSSSQASITAGTLALMAGGVPIKAPVAGIAMGLISDGTNYTVLTDIQGLE
DHFGDMDFKVAGTRDGITALQMDIKIDGITPQILEEALAQAKKARFEILDVIEATIPEVR
PDLAPTAPKIDTIKIDVDKIKIVIGKGGETIDKIIAETGVKIDIDEDGLVAIFSPDRAAI
ERTKEIIAGLVREAKVDEVFQAKVVRLEKFGAFVNLFDKTDALVHVSEMAWTRVNKPEDL
VEVGDVVDVKVIKIDDKGRIDASMKALLPKPEGYVEPEKRERSEKPRRHKEHKEKKDNNF
GEFKFHKVDKK
Download sequence
Identical sequences gi|146321779|ref|YP_001201490.1| 391296.SSU98_1932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]