SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 391735.Veis_0367 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391735.Veis_0367
Domain Number 1 Region: 103-247
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.88e-24
Family AlaX-like 0.0091
Further Details:      
 
Domain Number 2 Region: 1-84
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000113
Family AlaX-M N-terminal domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 391735.Veis_0367
Sequence length 252
Comment (Verminephrobacter eiseniae EF01-2)
Sequence
MTQDLFRQDAYLRECSAQITAVTADGAIVLDRTVFYPQGGGQAGDSGLLLRADGSSITIA
DTRKGKDAQGHATADIVHIPAPGQQDRMAQWTPGTAVTARIAWERRHRMMRLHTTTHLLC
HLVPHLVNGCSITPDYARLDFAITDPLDKQALNTGIAALVAAAHPLTVASISDAELDANP
ALVKSMSVQPPRGTGRIRTIRIGGQSASAALIDLQPCGGTHVANTAEIGAIVVTKIEKKS
ATTRRVVLGFAQ
Download sequence
Identical sequences A1WEV0
WP_011808174.1.29080 gi|121607368|ref|YP_995175.1| 391735.Veis_0367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]