SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 391735.Veis_4783 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391735.Veis_4783
Domain Number 1 Region: 3-95
Classification Level Classification E-value
Superfamily SMAD/FHA domain 4.02e-26
Family FHA domain 0.0014
Further Details:      
 
Domain Number 2 Region: 154-234
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000021
Family FHA domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 391735.Veis_4783
Sequence length 236
Comment (Verminephrobacter eiseniae EF01-2)
Sequence
MPRMIVSIDGVVVREVQLTKERTTLGRRPYNDIAIDHLAVSGEHAVIHMDMASQGVEIED
LGSTNGTYVNAKAIKRQALRNGDTVELGKYKIRFVQRAGDRSYDKTSFAKLGNSGAAPLP
APAAKAAPAAPIAPTAPTAPATPAAPALASASALIRVISGAAAGRTVALQKVVTTIGKPG
VAIASITKRQQDFVLAHVEGPDMPQLNGALIGTTPVPLKNGDRLQLAGTEMRFEHG
Download sequence
Identical sequences A1WS68
gi|121611686|ref|YP_999493.1| WP_011812453.1.29080 391735.Veis_4783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]