SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 391904.Blon_2270 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391904.Blon_2270
Domain Number 1 Region: 9-152
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.57e-45
Family Ribonuclease PH domain 1-like 0.000000692
Further Details:      
 
Domain Number 2 Region: 327-499
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-42
Family Ribonuclease PH domain 1-like 0.00000116
Further Details:      
 
Domain Number 3 Region: 153-262
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.98e-25
Family Ribonuclease PH domain 2-like 0.000024
Further Details:      
 
Domain Number 4 Region: 481-579
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.73e-23
Family Ribonuclease PH domain 2-like 0.0000283
Further Details:      
 
Domain Number 5 Region: 589-676
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.85e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 
Domain Number 6 Region: 266-352
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.41e-16
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.001
Further Details:      
 
Domain Number 7 Region: 652-732
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000015
Family Cold shock DNA-binding domain-like 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 391904.Blon_2270
Sequence length 914
Comment (Bifidobacterium longum infantis ATCC 15697)
Sequence
MEGPEIKAVEAVIDNGSFGKRTLRFETGRLAQQADGAVAAYLDDDSMILSTTTAGSSPKE
NYDFFPLTVDVEEKMYAAGKIPGSFFRREGRPSSEAILACRIIDRPLRPLFPHTLRNEVQ
VVETVLAVNPDDAYDVIALNAASASTMISGLPFEGPVSGVRLALIDGQWVAFPRWSERER
AVFEIVVAGRVVENGDVAIAMIEAGAGKNAWHLIYDEGQTKPDEEVVAGGLEAAKPFIKV
ICEAQDELKKIAAKETKEFQLFPEYTDELYARIDEIAHKDLDEALSIAEKLPRQDRIHEI
KEHVREVLADEFTDMDDAEKDKELGNAFKELQRQIVRRRILTEDYRIDGRGLRDIRTLSA
EVDIVPRVHGSALFQRGETQILGVTTLNMLKMEQQIDALSGPQSKRYMHNYEMPPYSTGE
TGRVGSPKRREIGHGALAEKALVPVLPSREEFPYAIRQVSEAIGSNGSTSMGSVCASTLS
LLAAGVPLKAPVAGIAMGLVSGDVDGQHIFKTLTDILGAEDAFGDMDFKVAGTSEFITAL
QLDTKLDGIPADILAAALQQAKEARATILEVINECIDGPAEMSEFAPRIITTSVPVEKIG
EVIGPKGKMINQIQEDTGAEIAIEDDGTVFISSEGGEAAKKAKSIIDSIANPHVPEAGET
YNGKVVKTTSFGAFVNLTPGTDGLLHISQIRNLANGERIDAVEDVLREGDTVEVIVQGVD
DRGKISLAIPGFEDQENNARPSRGDRDDRRGGRGRGDRDDRRGGRGRRSDRDDRDFDDRD
DRPRRRRSDDFEDDYDDRPRRRRSDDRDFDRDDRDDDRPRRRRSADRDFDDRDDRDARDS
RDDDRPRRRRSADRDDRGDRDDRRGGFRGGRGRGSDRNPRYATDDNYDDYRADREERTER
PRRRVRRDFDPFED
Download sequence
Identical sequences B7GNH2
391904.Blon_2270 gi|213693120|ref|YP_002323706.1| WP_012578501.1.101695 WP_012578501.1.11785 WP_012578501.1.12559 WP_012578501.1.30595 WP_012578501.1.38041 WP_012578501.1.40827 WP_012578501.1.48267 WP_012578501.1.69278 WP_012578501.1.70852 WP_012578501.1.8081 WP_012578501.1.86319 WP_012578501.1.91730 WP_012578501.1.99918 gi|213693120|ref|YP_002323706.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]