SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 393305.YE0977 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  393305.YE0977
Domain Number 1 Region: 172-339
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 6.18e-18
Family Lambda integrase-like, catalytic core 0.0053
Further Details:      
 
Weak hits

Sequence:  393305.YE0977
Domain Number - Region: 11-61
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00779
Family Calponin-homology domain, CH-domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 393305.YE0977
Sequence length 401
Comment (Yersinia enterocolitica 8081)
Sequence
MKKYAINSFVFDNGERFCHVVDKITGEPIYYPNLYLITQVRNRSNSINTIQSIAGILAML
HSYFAINNIDIEERIFKLEFLSFNEIEVLSDYMSRNYKQGKGTPSGKLPVAKNPTNYFRF
SVICDYMQWLCKVYLTLSNDKNVELKIKNFITSVKSKRPSNVDRYKKEIPDKALNQKQLD
YLFDIVKPKSDNNPFSSEVQKRNQLIMLLLYSFGIRAGELLNLRISDIDFAHSTIAIKRR
ADDKSDPRVNQPLVKTCERKLPVGEALMGEIYNYIIVERNKVKNAKGNDFLFITNKLGKT
VGMPLSMSAYHKIINIISKAHPELNELSGHMLRHTWNYEFSRMMDERDKPFSEEKEAQVR
SYIMGWVVDSEMAKIYNARHIVEQAHKTSLVIQNEFMERAI
Download sequence
Identical sequences A1JKG4
gi|123441324|ref|YP_001005311.1| WP_011815728.1.51324 YP_001005311.1.77335 393305.YE0977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]