SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 393305.YE1275 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  393305.YE1275
Domain Number - Region: 18-45
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0549
Family Tachycitin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 393305.YE1275
Sequence length 103
Comment (Yersinia enterocolitica 8081)
Sequence
MSDATVGSTNNRCSAEETAACCCIDVGTIMDNTDCTASYSCVFDNRVEAEAMLKTLTEKA
RAVESEPCLIEHKLEETDGGVRLTVDFTFACQAETMIFQLGLR
Download sequence
Identical sequences A0A0T9SK93 A1JK21
WP_005171954.1.100034 WP_005171954.1.23750 WP_005171954.1.28488 WP_005171954.1.29173 WP_005171954.1.39120 WP_005171954.1.39701 WP_005171954.1.51324 WP_005171954.1.62658 WP_005171954.1.69335 WP_005171954.1.7032 WP_005171954.1.75090 WP_005171954.1.80986 WP_005171954.1.91311 WP_005171954.1.98085 YP_001005596.1.77335 gi|123441611|ref|YP_001005596.1| 393305.YE1275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]