SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 393595.ABO_0333 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  393595.ABO_0333
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.89e-51
Family Ribonuclease PH domain 1-like 0.0000215
Further Details:      
 
Domain Number 2 Region: 292-490
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.62e-46
Family Ribonuclease PH domain 1-like 0.0000244
Further Details:      
 
Domain Number 3 Region: 451-551
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.61e-29
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 4 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.66e-27
Family Ribonuclease PH domain 2-like 0.0013
Further Details:      
 
Domain Number 5 Region: 558-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.83e-24
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 
Domain Number 6 Region: 622-696
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.98e-21
Family Cold shock DNA-binding domain-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 393595.ABO_0333
Sequence length 697
Comment (Alcanivorax borkumensis SK2)
Sequence
MFNKITKQIQFGRDTVTLETGQIARQATAAVMVRIGDTQVLVTVVGRKEANPGQNFFPLT
VNYQEKTYATGRIPGGFLKREGRPSEKETLTCRLIDRPIRPLFPKGFMNEVQVVATVMSS
DKNRDPDIAALIGTSAALSISGIPFSGPIGAARVGYKDGMYILNPSYSELAESALDLVVA
GTEPAVLMVESEAQELSEDQMLGAVLFGHMEMQPLIQGIKEFAAEVGTETWDWKPAEQNE
TLKAAIKDKFAAALGEAYTITEKMARYAKVGELRDACVAEFATGEDGAPEADEVKDLFGK
IEKSVVREAVVSGKPRIDGRALDAVRAIDCQVGTLAKTHGSALFTRGETQAIVTATLGGM
RDAQFIDALEGSHQDHFMLQYNFPPYCVGETGFIGSPKRREIGHGRLARRGVEAVVPSVQ
DFPYTIRVVSEITESNGSSSMASVCGTSMALMDAGVPLTAPVAGIAMGLVKEEDGRYAVL
SDILGDEDHLGDMDFKVAGTARGVTALQMDIKIEGITEEIMEKALNQANAGRLHILGEMN
KAIAESRSEVSDNAPTLLTLKINPDKIRDVIGKGGATIRALTEETGCTIDIEDDGSVKIY
GETREKADEAVRRVEEITAEAEVGAIYEGKVTRVVDFGAFVAIMPGTEGLLHISQIAEER
VEKVTDYVNEGEIIKVKVLDVDQRGRIKLSMKEAKED
Download sequence
Identical sequences Q0VSR7
WP_011587628.1.14994 WP_011587628.1.66393 WP_011587628.1.75482 gi|110833194|ref|YP_692053.1| 393595.ABO_0333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]