SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 394.NGR_b00740 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  394.NGR_b00740
Domain Number 1 Region: 18-143
Classification Level Classification E-value
Superfamily HSP20-like chaperones 8.72e-27
Family HSP20 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 394.NGR_b00740
Sequence length 146
Comment (Rhizobium NGR234)
Sequence
MLHHLENTGRWLDPLRQMRFAQRDMSRLLDNLRLAAPPEFPLMNIWAGTDGAVVTAEIPG
VAPEELDIAVHQNMVTLRGSRPAEPLAEDAVIHRQERATGAFARNLILPFRVDGDHATAK
FRNGLLRLDLPRPKADRPHKINVSRS
Download sequence
Identical sequences C3KMX2
gi|227818327|ref|YP_002822298.1|NC_012586 394.NGR_b00740 YP_002822298.1.63916 gi|227818327|ref|YP_002822298.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]