SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 394.NGR_b17830 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  394.NGR_b17830
Domain Number 1 Region: 33-104
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000549
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 394.NGR_b17830
Sequence length 112
Comment (Rhizobium NGR234)
Sequence
MEIKEEEYRVWSEGKDIYLDGTMRLPSTEAYAPIYSLVMSILEAEPDRLTIDVTGLQFLN
SSGINLLAKLTIEARKRPNIQFTVRGSSEFPWQSKSLPNLKKLHPGVDLRLG
Download sequence
Identical sequences Q6W2D1
394.NGR_b17830 gi|227820016|ref|YP_002823987.1|NC_012586 gi|227820016|ref|YP_002823987.1| YP_002823987.1.63916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]