SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 394221.Mmar10_2023 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  394221.Mmar10_2023
Domain Number 1 Region: 57-194
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 8.76e-23
Family Band 7/SPFH domain 0.011
Further Details:      
 
Weak hits

Sequence:  394221.Mmar10_2023
Domain Number - Region: 185-253
Classification Level Classification E-value
Superfamily OmpH-like 0.0602
Family OmpH-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 394221.Mmar10_2023
Sequence length 292
Comment (Maricaulis maris MCS10)
Sequence
MIRTLGIIILVVAVFIGLQSVYIVSETQQALILRLGEPVDAVNETSEPDPGLHFKTPFIM
DVLIFDKRNLELDLDAEEILASDQERLIVDAFLRYRITDPLRFYQTFRDERGAVVRLEQI
MDDSLRGVIASIPSSDVISGQRADLMTRVQAAVEAQVLTGRFGIEVIDVRILAADLPPQI
ADNVFERMRSERQQEAAQYRAEGEQRATEIRADADRQASIIRAQARADAQRLRGEGDARQ
NQIYAEAYNRDPEFFAFYRSMLAYEQAVQSGTPIVIPPDSEFFRYFRSETGE
Download sequence
Identical sequences A0A2D5JZ28 Q0AN22
394221.Mmar10_2023 gi|114570573|ref|YP_757253.1| WP_011643960.1.83773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]