SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 394221.Mmar10_2785 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  394221.Mmar10_2785
Domain Number 1 Region: 2-82
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 9.07e-34
Family Ribosomal L27 protein 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 394221.Mmar10_2785
Sequence length 89
Comment (Maricaulis maris MCS10)
Sequence
MAHKKAGGSSRNGRDSAGRRLGVKKYGGQEVIPGNIIVRQRGTKVNPGANVGMGKDHTLF
ALTEGRVVFAKKSGGKAFVSVEPIAKAAE
Download sequence
Identical sequences A0A2D5JX21 Q0AKX6
WP_011644711.1.83773 394221.Mmar10_2785 gi|114571325|ref|YP_758005.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]