SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 395019.Bmul_1024 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395019.Bmul_1024
Domain Number 1 Region: 3-146
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.81e-51
Family Ribonuclease PH domain 1-like 0.0000137
Further Details:      
 
Domain Number 2 Region: 301-495
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.02e-50
Family Ribonuclease PH domain 1-like 0.0000167
Further Details:      
 
Domain Number 3 Region: 147-237
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.49e-30
Family Ribonuclease PH domain 2-like 0.0012
Further Details:      
 
Domain Number 4 Region: 457-556
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.65e-28
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 5 Region: 561-647
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.74e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 
Domain Number 6 Region: 627-706
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.74e-21
Family Cold shock DNA-binding domain-like 0.00036
Further Details:      
 
Domain Number 7 Region: 241-328
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.1e-16
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 395019.Bmul_1024
Sequence length 715
Comment (Burkholderia multivorans ATCC 17616 JGI)
Sequence
MSMFNKVVKEFQWGQHKVRLETGEIARQASGAVIVDVEDTVVLATVVGAKSAKPGQDFFP
LTVDYIEKTYSAGKIPGGFFRREGRPSEHETLTSRLIDRPLRPLFPEGFYNEVQVVIHVL
SVNPEIPADIPALIGASAALAVSGLPFNGPVGAARVAYVNDQYVLNPTREQLKSSRLDLV
VAGTERAVLMVESEADQLPEEVMLGAVVFGHEQMQTAIDAIHELVRDGGKPEWDWQPAPK
DEALIARVTEIAQPELLAAYQIRDKQARSTKLKEVYAATSAKLEEDALAAGTVAADKATV
GNILFDLEAKIVRGQILNGEPRIDGRDTRTVRPIEIRTGVLPRTHGSALFTRGETQALVV
ATLGTKGDEQIIDALEGEYRERFMLHYNMPPFATGETGRVGSPKRREIGHGRLAKRALVA
CLPSAEEFGYSIRVVSEITESNGSSSMASVCGGCLALMDAGVPMKAHVAGIAMGLILEGN
KFAVLTDILGDEDHLGDMDFKVAGTAQGVTALQMDIKIQGITKEIMQVALAQAKEGRMHI
LGKMTEAVAGANTQLSEFAPRMITIKINPEKIRDVIGKGGSVIRALTEETGTTIDISDDG
VVTIASTSSEGMAEAKKRIENITAEIEVGQVYEGTVLKLLDFGAIVNLLPGKDGLLHISE
IVNERVKDINDYLKEGQQVKVKVIQTDEKGRVRLSAKALLNEAAAAAQSDTPPQQ
Download sequence
Identical sequences A0A1W0ZR84 A9AJP0 J5BGX9
WP_006410113.1.101207 WP_006410113.1.11863 WP_006410113.1.17778 WP_006410113.1.19915 WP_006410113.1.23373 WP_006410113.1.23823 WP_006410113.1.25176 WP_006410113.1.26607 WP_006410113.1.38187 WP_006410113.1.38686 WP_006410113.1.42384 WP_006410113.1.43525 WP_006410113.1.49281 WP_006410113.1.52658 WP_006410113.1.54573 WP_006410113.1.60510 WP_006410113.1.66141 WP_006410113.1.66697 WP_006410113.1.66940 WP_006410113.1.7115 WP_006410113.1.73018 WP_006410113.1.74059 WP_006410113.1.78867 WP_006410113.1.8115 WP_006410113.1.81730 WP_006410113.1.82554 WP_006410113.1.84428 WP_006410113.1.95489 gi|189351043|ref|YP_001946671.1| gi|189351043|ref|YP_001946671.1| 395019.Bmul_1024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]