SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 395491.Rleg_1163 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395491.Rleg_1163
Domain Number 1 Region: 59-135
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.0000000000000806
Family Dual specificity phosphatase-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 395491.Rleg_1163
Sequence length 176
Comment (Rhizobium leguminosarum bv trifolii WSM1325)
Sequence
MTFIVVSPLSRIAEMAVRHKARDMISLIAKEQAFHRPGVIAAERHLTLAMNDIVFKGTGD
LVAPDETHVRGIIDFAASWRQETPLLIHCWMGVSRSPAAALIAALSLAPDQSDETLARRL
RAASPFATPNARLIQIGDALLGRSGRLVAAVRAIGRGADADGNAPFVLAIRDAACG
Download sequence
Identical sequences C6ATI2
WP_012756800.1.14669 gi|241203901|ref|YP_002974997.1| 395491.Rleg_1163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]