SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 395491.Rleg_4278 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  395491.Rleg_4278
Domain Number - Region: 82-118
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00628
Family BAR domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 395491.Rleg_4278
Sequence length 144
Comment (Rhizobium leguminosarum bv trifolii WSM1325)
Sequence
MNQSALLRPDWTPATIALMILGFMVFWPLGLAMLAYIIFGDRLRGFKRDVNQATDGFFAS
CRRPHGRHRPHFSTGNGAFDDWRKAELDRMEEERRKLDEMREEFDSYLRELRRAKDQEEF
DRFMRDRRNAKRDDNGPVAEYQTP
Download sequence
Identical sequences C6B114
395491.Rleg_4278 gi|241206961|ref|YP_002978057.1| WP_012759556.1.14669 WP_012759556.1.67177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]