SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 395491.Rleg_4382 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395491.Rleg_4382
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.21e-51
Family Ribonuclease PH domain 1-like 0.0000226
Further Details:      
 
Domain Number 2 Region: 298-469
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.37e-49
Family Ribonuclease PH domain 1-like 0.0000149
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.33e-30
Family Ribonuclease PH domain 2-like 0.0013
Further Details:      
 
Domain Number 4 Region: 451-546
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.73e-27
Family Ribonuclease PH domain 2-like 0.00014
Further Details:      
 
Domain Number 5 Region: 556-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.78e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 6 Region: 621-704
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.43e-20
Family Cold shock DNA-binding domain-like 0.00057
Further Details:      
 
Domain Number 7 Region: 240-322
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 6.8e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 395491.Rleg_4382
Sequence length 712
Comment (Rhizobium leguminosarum bv trifolii WSM1325)
Sequence
MFDTHTVEIEWAGRPLKLETGKIARQADGAVLATYGETVVLATVVSAKAPKAGQDFFPLT
VNYQEKTYAAGKIPGGYFKREGRPSEKETLVSRLIDRPIRPLFPEGYKNDTQVVVTVIQH
DLENDPDVLSMVATSAALTLSGVPFMGPVGGARVGYINGEYVLNPHLDEMDESSLDLVVA
GTYDAVLMVESEAKELNEDIMLGAVMFGHKGFQPVLDAIIKLAEVAAKEPRDFQPADYSA
LETEMLGLAEGELREAYKITQKADRYAAVDAVKAKVKAHFLPEEGEAKYTAEEVGAIFKH
LQAKIVRWNILDTKSRIDGRNLETVRPIVSEVGLLPRTHGSALFTRGETQAIVVATLGTG
EDEQYVDSLTGMYKERFLLHYNFPPYSVGETGRMGSPGRREIGHGKLAWRAIRPMLPTPE
QFPYTLRVVSEITESNGSSSMATVCGTSLALMDAGVPLAKPVAGIAMGLILEGDRFAVLS
DILGDEDHLGDMDFKVAGTADGITSLQMDIKITGITEEIMKVALGQAQGGRVHILGEMSK
AITESRGQLGEFAPRIEVMNIPVDKIREVIGSGGKVIREIVEKTGAKINIEDDGTVKIAS
SSGKEIEAARKWIHSIVAEPEIGQVYEGTVVKTADFGAFVNFFGARDGLVHISQLASERV
AKTQDVVKEGDKVWVKLLGFDERGKVRLSMKVVDQATGQEIPNEKKKEEAAE
Download sequence
Identical sequences C6B217
gi|241207064|ref|YP_002978160.1| 395491.Rleg_4382 WP_012759648.1.14669 WP_012759648.1.67177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]