SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 395491.Rleg_4557 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395491.Rleg_4557
Domain Number 1 Region: 27-197
Classification Level Classification E-value
Superfamily LigT-like 2.44e-22
Family 2'-5' RNA ligase LigT 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 395491.Rleg_4557
Sequence length 199
Comment (Rhizobium leguminosarum bv trifolii WSM1325)
Sequence
MNQMPFDFGDDKNGRGRRNESYVSGHRLFFALCPPDAVEQQAAAIGDDYRRAFSLSGMPR
LTTLHVSIIWVGDYPRLPEDVVFAARQAGATVESAPIAISFDRIMRFPQARSLVLCGEGG
RKPLTRLHVQLGVGMYNAGLRHNVGRDYKPHMTLLYDRKAVPPTTLDTPVSWTASEFLLI
HSVLGKTEHRIIDRWPLLG
Download sequence
Identical sequences C6B393
WP_012759805.1.14669 395491.Rleg_4557 gi|241207238|ref|YP_002978334.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]