SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 395491.Rleg_6183 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395491.Rleg_6183
Domain Number 1 Region: 8-200
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 9.68e-34
Family Glycerol-3-phosphate (1)-acyltransferase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 395491.Rleg_6183
Sequence length 206
Comment (Rhizobium leguminosarum bv trifolii WSM1325)
Sequence
MIAIIRRFLVLLVRILVGARSEWRGCAPDPSRRIYFANHNSHIDTVAVMAALPWPVRRMT
HPVAARDYWGTSAFRRFIAEKGLRAVLIDRKPPPDTDPLAPIERLLEEGRSVLIFPEGTR
STNDEIAPFRSGIFRLACRFPDVDLVPIHLDNLQRILPKGSMLIVPITCTARFGKPLRVE
PGEEKTEFLARARAAVIELADGGHSA
Download sequence
Identical sequences C6B9R6
gi|241258805|ref|YP_002978689.1| gi|241258805|ref|YP_002978689.1|NC_012852 395491.Rleg_6183 WP_012760083.1.14669 WP_012760083.1.54942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]