SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 395492.Rleg2_0869 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395492.Rleg2_0869
Domain Number 1 Region: 37-205
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 8.14e-33
Family Pentapeptide repeats 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 395492.Rleg2_0869
Sequence length 233
Comment (Rhizobium leguminosarum bv trifolii WSM2304)
Sequence
MAKHGSSLGLLALVLLAFPPVAARAADCGSLASPKLDWQECTKKNLMLQGSDLEGANLVG
TDFSLTDLAGANVKSANLEKATLVRASLEGAHAEGASFAKIEAYRASFANIIAEGASFAG
AELQRANFAGARLAGASFEKAELGRADFDKAVLTGTKFSFANLSRADLSGASFEGPAVFE
RAFMFLTRIEGLDLSAASGLEQTQIDLACGDTSTKLPAGLSAPTTWPCPAEHE
Download sequence
Identical sequences A0A0N1MGL6 B5ZVA4
gi|209548472|ref|YP_002280389.1| WP_012557029.1.20038 WP_012557029.1.46073 395492.Rleg2_0869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]