SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 395495.Lcho_1497 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395495.Lcho_1497
Domain Number 1 Region: 4-146
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.16e-49
Family Ribonuclease PH domain 1-like 0.0000139
Further Details:      
 
Domain Number 2 Region: 298-490
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.28e-47
Family Ribonuclease PH domain 1-like 0.0000289
Further Details:      
 
Domain Number 3 Region: 147-238
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.16e-29
Family Ribonuclease PH domain 2-like 0.0008
Further Details:      
 
Domain Number 4 Region: 452-550
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.1e-27
Family Ribonuclease PH domain 2-like 0.0001
Further Details:      
 
Domain Number 5 Region: 557-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.59e-24
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 6 Region: 622-705
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.39e-20
Family Cold shock DNA-binding domain-like 0.00024
Further Details:      
 
Domain Number 7 Region: 241-323
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000000000000222
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 395495.Lcho_1497
Sequence length 767
Comment (Leptothrix cholodnii SP 6)
Sequence
MSLFNKVTKTFQWGQHTVTLETGEISRQAGGAVIVNIDDTVVLATVVGAKNAKPGQDFFP
LTVDYIEKTYAAGKIPGSFFKREAKPSELEVLTSRLIDRPLRPLFPEGFYNEVHVVVHVL
SLNPEASADIAALIGSSAALAISGIPFNGPVGAARVGYVNGEYVLNPGPTQLKSSKMDLV
VAGTEAAVLMVESEADQLTEEVMLGAVVYGHEQAKVAIAAINELVRDAGKPAWDWQPPAR
NEPLIAKVAEFGLAKIEAAYQIRNKQARTHACRAAYAEVKISLAEAGVVFDNVDVDNLLF
ELEAKTVRGQILQGEPRIDGRDTRTVRPIEIRTGVLPRTHGSALFTRGETQALVVATLGT
DQDSQRIDALAGDFRDSFLFHYNMPPFATGEVGRMGTTKRRETGHGRLAKRALVPLLPPK
DEFGYTIRVVSEITESNGSSSMASVCGGCLAMMDAGVPMKAHVAGIAMGLIKEGNRFAVL
TDILGDEDHLGDMDFKVAGTTAGVTALQMDIKIQGITKEIMQVALAQAKEARLHILGKMV
EAMGTANTEVSNFAPRLYTMKINPEKIRDVIGKGGSVIRALTEETGCQIDIGEDGTITIA
STDADKAELAKKRIADITAEAEIGKVYEGPVVKILDFGALINILPGKDGLLHISQIAHQR
VEKVTDFLTEGQVVKVKVLETDEKGRIKLSMKALIERPEGMEFEERAPRREGGFGDRGDR
GDRGPRRDRGGDRPERGERPARAEQPATEESGAPAAGQPQQQQGQQQ
Download sequence
Identical sequences B1Y823
gi|171058181|ref|YP_001790530.1| 395495.Lcho_1497 WP_012346527.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]