SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 395495.Lcho_2712 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395495.Lcho_2712
Domain Number 1 Region: 56-221
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 9.5e-31
Family ATP-dependent DNA ligase catalytic domain 0.02
Further Details:      
 
Domain Number 2 Region: 196-299
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.34e-28
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 395495.Lcho_2712
Sequence length 303
Comment (Leptothrix cholodnii SP 6)
Sequence
MDTRPDRRRWLAWGLAQAWAVPMAGALGSLGLRHDSARAEPLAPVPPALLLARPAGPDLD
VSSHLVSEKLDGVRAFWSGRQLLLRSGIPIRAPADFTARLPTRALDGELWLGRSRFDAMS
ALIRREHSADDPLWREVRYAVFELPDAPGDFAQRHRAMRELLPGTDAVAGAHVVQQRRLD
DRQELDRWLAEVIAAGGEGLMLHRADAPYVTGRSDWLLKLKPQLDAEAMVIGHLPGKGRH
AGRLGALRVRTPDGREFALGSGLSDAERDDPPAPGRWVTYRYRGLTNSGLPRFATFWRMH
DLP
Download sequence
Identical sequences B1Y8A7
WP_012347731.1.27902 gi|171059393|ref|YP_001791742.1| 395495.Lcho_2712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]