SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 395495.Lcho_3991 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395495.Lcho_3991
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 7.06e-19
Family Ribosomal protein L29 (L29p) 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 395495.Lcho_3991
Sequence length 65
Comment (Leptothrix cholodnii SP 6)
Sequence
MKASELRAKDVAALEKEISDLLKAHFGLRMQKATQQLTNHSVIKQTRRDIARARTILTEK
KKGAA
Download sequence
Identical sequences B1Y8H9
gi|171060661|ref|YP_001793010.1| WP_012348990.1.27902 395495.Lcho_3991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]