SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 395961.Cyan7425_4265 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395961.Cyan7425_4265
Domain Number 1 Region: 299-496
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.09e-48
Family Ribonuclease PH domain 1-like 0.00000635
Further Details:      
 
Domain Number 2 Region: 4-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.27e-44
Family Ribonuclease PH domain 1-like 0.0000322
Further Details:      
 
Domain Number 3 Region: 459-557
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.09e-27
Family Ribonuclease PH domain 2-like 0.00013
Further Details:      
 
Domain Number 4 Region: 143-233
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.01e-26
Family Ribonuclease PH domain 2-like 0.0015
Further Details:      
 
Domain Number 5 Region: 565-649
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.01e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 6 Region: 627-705
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.77e-18
Family Cold shock DNA-binding domain-like 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 395961.Cyan7425_4265
Sequence length 715
Comment (Cyanothece PCC 7425)
Sequence
MTEVEKKISFDGRDIHITIGRFAPQAGGTVMIRSGDTAVLVTATRAAAREGIDFLPLLVD
YEERLYAAGRIPGGFLRREGRPPEKATLISRLIDRPLRPLFPGWLRDDIQVVATTLSMDE
QVPPDVLAVTGASVAVLLAQIPFNGPMAAVRVGLVGDDFIINPTYSEIEAGDLDLVVAGS
PAGVVMVEAGANQLPEQDVIEAIDFGYEAVRDLIRAQQELLTELGIALVQQDPPPRDPTL
ENFIRERAEAPVKEILARFEKDKNVRDAALDEVKAAIEQAIKELEETDPVRVAAALDAKA
LSNTFKEVTKTLMRRQVIEGNVRVDGRKLDEVRPISCLVGVLPRRVHGSALFNRGLTQVL
SAVTLGTPGDAQELDDLHPDESKRYLHHYNFPPFSVGETRPMRSPGRREIGHGALAERAL
VPVLPPQDQFPYVIRVVSEVLSSNGSTSMGSVCGSTLSLMDAGVPLTKPVSGAAMGLIKE
GDEVRILTDIQGIEDFLGDMDFKVAGTDSGITALQMDMKITGLSLQVVAEAIQQAKPARM
HILEKMLETLSQPRQETSPFAPRLVNLKIDPELIGLVIGPGGKTVKGITEETGAKIDIED
SGMITISASDEDKAKRARSIIMGMTRKLSAGDVYVGKVTRIIPIGAFVEFLPGKEGMIHI
SQLADYRVNKVEDEVSVGDEVIVKVREIDGRGRINLTRLGIHPDEAAAARAAVAS
Download sequence
Identical sequences B8HXN3
gi|220909628|ref|YP_002484939.1| WP_012629626.1.77409 395961.Cyan7425_4265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]