SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 395962.Cyan8802_3649 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  395962.Cyan8802_3649
Domain Number - Region: 173-204
Classification Level Classification E-value
Superfamily SH3-domain 0.00486
Family SH3-domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 395962.Cyan8802_3649
Sequence length 229
Comment (Cyanothece PCC 8802)
Sequence
MLIMTVKVPSIFEPVNQGFIIMAIVGFLLIVLAALTVAAPDLIKADSAQRPPLLRIPLVG
LLLALIGVGSVPLLFLLGIYPFMIGMVGWSGHLWWYWQNGVYPTLPPESWIIKAVGVILA
RLFIAVVGHFKPLLKTHTIAEQLIPERLIGSRGTILSVLGKGLIEVNVYDNFGRFYVQIY
GFAWENATDLDFKVGDNVYIVDLIAPRRYTFVKADSNDELQVITAYRRI
Download sequence
Identical sequences 395962.Cyan8802_3649 WP_015784801.1.62203 gi|257061409|ref|YP_003139297.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]