SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 395963.Bind_0512 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395963.Bind_0512
Domain Number 1 Region: 57-162
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.0000000000000011
Family HSP20 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 395963.Bind_0512
Sequence length 166
Comment (Beijerinckia indica ATCC 9039)
Sequence
MPKGDAGRVAQRRPKGFAREIFLQMSRLPTLNSPFLLGFDEIERALDRATRMASDGYPPY
NIERIARDGTQTEMLRITLAVAGFTREQLEITIEDGQLLIRGRQQDDKARHYLHRGIAAR
QFQRVFLLADGMQVSGADLTNGLLSIDLIRPDPSRVVQKIEIAVRD
Download sequence
Identical sequences B2IEX3
WP_012383522.1.21334 gi|182677507|ref|YP_001831653.1| 395963.Bind_0512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]