SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 395963.Bind_2606 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  395963.Bind_2606
Domain Number - Region: 53-89
Classification Level Classification E-value
Superfamily SH2 domain 0.0309
Family SH2 domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 395963.Bind_2606
Sequence length 96
Comment (Beijerinckia indica ATCC 9039)
Sequence
MGQINYSRLKGKIDRFKPALSGNPHLWMLVDAGSDSFFATVNVQSSKGSSGSPVAETYLN
FLVDGTFAIRSSNTSGTSALVSRSKSAAMRLVLSTT
Download sequence
Identical sequences B2IIY6
395963.Bind_2606 gi|182679541|ref|YP_001833687.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]