SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 396513.Sca_0927 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  396513.Sca_0927
Domain Number 1 Region: 319-469
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.59e-29
Family HD domain 0.014
Further Details:      
 
Domain Number 2 Region: 207-303
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.22e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Weak hits

Sequence:  396513.Sca_0927
Domain Number - Region: 34-80
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.00288
Family F1F0 ATP synthase subunit B, membrane domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 396513.Sca_0927
Sequence length 519
Comment (Staphylococcus carnosus TM300)
Sequence
MNLLTLLLILLGCILGVVVGYIAAQKVLHEKQVQAKQTADDIINQANKEADNLKKERLLE
AKEENQRLKEQTENELREIRGNLQKQEARLLQKEDNLERKSDLLDKKDEILEQKESKIEE
KQQQVDTKESSVQSIIMKHEQELERISGLTREEAINEQFQRVEEELSQDIAVLVKEKENE
AKEKVDKSAKELLATTVQRLAAEHTSESTVSVVNLPNDEMKGRIIGREGRNIRTLETLTG
IDLIIDDTPEAVILSGFDPIRREIARTALVNLVSDGRIHPGRIEDMVEKARKEVDDIIRD
AGEQATFEINVHNMHPDLVKILGRLKFRTSYGQNVLKHSIEVAHLTGMLAAELGEDVTLA
KRAGLLHDVGKAIDHEVEGSHVEIGVELAKKYHESETVINAIHSHHGDVEPTSIISILVA
AADALSAARPGARKETLENYIRRLERLEALSESYDGVEKAFAIQAGREIRVIVSPDEIDD
LKAHRLARDIKKQIEDELQYPGHIKVTVVRETRAIEYAK
Download sequence
Identical sequences B9DPC6
396513.Sca_0927 gi|224476414|ref|YP_002634020.1| WP_015900176.1.31717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]