SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 396513.Sca_1193 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  396513.Sca_1193
Domain Number 1 Region: 108-287
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.42e-37
Family Extended AAA-ATPase domain 0.088
Further Details:      
 
Domain Number 2 Region: 8-64
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000124
Family Eukaryotic type KH-domain (KH-domain type I) 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 396513.Sca_1193
Sequence length 315
Comment (Staphylococcus carnosus TM300)
Sequence
MPGIIVIDDINQAQALIGNNDENIQAIEEAFEVIIHARGQEIAVKGQQQEEIEKAEAVIK
NLLKVIDQGVTINLKDVEAAIKMAQKGSINHLVDLYDESITKDAYGKTIRAKTMGQRLYL
NAMKHNDLVFGIGPAGTGKTFLAVVYAAKELRQGNVKRIVLTRPAVEAGESLGFLPGDLK
EKVDPYLRPLYDGLHTVLGPEQTARFIERGIIEVAPLAYMRGRTLDDAFVILDEAQNTTH
AQMKMFLTRLGFGSKMVVTGDMTQVDLPRGIKSGLKQAVKRLAGVKGISVQKLDQSDVVR
HPLVSKIIDRYEGDE
Download sequence
Identical sequences A0A2K4EQ28 B9DNL7
gi|224476679|ref|YP_002634285.1| WP_015900441.1.20588 WP_015900441.1.31717 WP_015900441.1.3311 WP_015900441.1.88899 396513.Sca_1193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]