SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 396588.Tgr7_0319 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  396588.Tgr7_0319
Domain Number 1 Region: 2-136
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 2.22e-43
Family N-terminal domain of MutM-like DNA repair proteins 0.0000167
Further Details:      
 
Domain Number 2 Region: 132-223
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.15e-29
Family Middle domain of MutM-like DNA repair proteins 0.0011
Further Details:      
 
Domain Number 3 Region: 219-270
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.68e-16
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 396588.Tgr7_0319
Sequence length 271
Comment (Thioalkalivibrio HL EbGR7)
Sequence
MPELPEVETTRRGIERHVTGRRVTSVIVREPRLRWPVPGDLAERLTGHTLGRVLRRAKYL
LIEVDTGLLLLHLGMSGSLRVVTPDAPLRKHDHIDLCLDSGRCLRLHDPRRFGAVLWIEG
PAHAHPLLAELGPEPLGKDFDADYLFRSTRKRRVAIKQHIMNSHVVVGVGNIYASEALFL
AGIRPGRAAGRLTRAECARLVETIRQVLGEAIAQGGTTLRDFVREDGSHGYFQQHLRVYG
RTGLACMACETPVKQIVQGNRSTYYCPACQR
Download sequence
Identical sequences B8GUQ6
gi|220933505|ref|YP_002512404.1| 396588.Tgr7_0319 WP_012636906.1.30883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]