SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 397948.Cmaq_0366 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  397948.Cmaq_0366
Domain Number 1 Region: 152-234
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.52e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.00044
Further Details:      
 
Domain Number 2 Region: 62-150
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.95e-19
Family Cold shock DNA-binding domain-like 0.00071
Further Details:      
 
Domain Number 3 Region: 2-62
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0000000023
Family ECR1 N-terminal domain-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 397948.Cmaq_0366
Sequence length 240
Comment (Caldivirga maquilingensis IC-167)
Sequence
MLNVTDRMIVLPGDLIGGRSNDYVIVGSVYWEGDKAYASTVAMINIKGDVKPMEVQVIPL
NGAYKPRQGDIVIGYVIDILVNGWEIDIKSPYSAYLPINEATLKPVDVVTADLRNILNIG
DIVLAKISDFNLAKDYPVTLTIKESRLGRIEDGTVIEIDPVKVPRVIGKRGSMVNMFKDE
LNCDVTVGQNGRIWVRCRNKRDELFVSQTIKFIEKESHQSGLMDKVKAIIQNYKSTSGLP
Download sequence
Identical sequences A8MBC2
gi|159040950|ref|YP_001540202.1| WP_012185432.1.60673 397948.Cmaq_0366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]