SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 397948.Cmaq_0861 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  397948.Cmaq_0861
Domain Number - Region: 68-141
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0981
Family CRAL/TRIO domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 397948.Cmaq_0861
Sequence length 151
Comment (Caldivirga maquilingensis IC-167)
Sequence
MLRVEYYKSQDEAINRLKEIADDAANMITKINTTIEYIKSNEARTISQGVLTIKSYNVLD
QKGRELYRLLYIGIMGNVDYESLNQLRHYYVTLSESLNSLMTSMSRMNINGHLIIIYLDE
VPIMIIHSLSESTLSDLINLINPKQNSTSGS
Download sequence
Identical sequences A8MD40
397948.Cmaq_0861 gi|159041434|ref|YP_001540686.1| WP_012185915.1.60673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]