SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 397948.Cmaq_0980 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  397948.Cmaq_0980
Domain Number 1 Region: 85-168
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.71e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00014
Further Details:      
 
Weak hits

Sequence:  397948.Cmaq_0980
Domain Number - Region: 25-76
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0633
Family Eukaryotic type KH-domain (KH-domain type I) 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 397948.Cmaq_0980
Sequence length 184
Comment (Caldivirga maquilingensis IC-167)
Sequence
MANYYFGGPLEIPLEKAKTLVTEEVKNSIEVNLKVQVEVKDDSVVLTPMQDANPDSVIKA
RQIIQALALGFSRDDALELLNDDKYLDVVDLSDYIGKDKENHLSRIKAIIIGEGGKVKRN
LEELTETKIAVKDKAVGIIGNYDNVRAVRDAIVMLINGRQHSTVYRWLQRWKRDLNLRRI
EGNF
Download sequence
Identical sequences A8MDF6
WP_012186031.1.60673 397948.Cmaq_0980 gi|159041550|ref|YP_001540802.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]