SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 398527.Bphyt_0809 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  398527.Bphyt_0809
Domain Number - Region: 22-74
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.000929
Family Mitotic arrest deficient-like 1, Mad1 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 398527.Bphyt_0809
Sequence length 151
Comment (Burkholderia phytofirmans PsJN)
Sequence
MSNPYQMNYRTPIAESWNHNIPLPTPEAAEDVSSMLERLKAESNSLESYFTELENELKRV
HLKRKIVGKKLGVLSELVKDVDALHAEPAVAVRTVAAGAETQTASRRSRKKQIFAVASII
LVALAIAFISLEKTGQISCVTCAPGRLLGLM
Download sequence
Identical sequences B2T0C6
gi|187922813|ref|YP_001894455.1| 398527.Bphyt_0809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]