SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 398577.BamMC406_2170 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  398577.BamMC406_2170
Domain Number 1 Region: 3-146
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-51
Family Ribonuclease PH domain 1-like 0.0000139
Further Details:      
 
Domain Number 2 Region: 300-495
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.72e-50
Family Ribonuclease PH domain 1-like 0.0000175
Further Details:      
 
Domain Number 3 Region: 147-237
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.03e-30
Family Ribonuclease PH domain 2-like 0.0015
Further Details:      
 
Domain Number 4 Region: 457-555
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.03e-28
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 5 Region: 561-647
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.34e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 
Domain Number 6 Region: 627-704
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.55e-21
Family Cold shock DNA-binding domain-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 398577.BamMC406_2170
Sequence length 714
Comment (Burkholderia ambifaria MC40 6)
Sequence
MSMFNKVVKEFQWGQHKVRLETGEVARQASGAVIVDVEDTVVLATVVGAKSAKPGQDFFP
LTVDYLEKTYSAGKIPGGFFRREGRPSEHETLTSRLIDRPLRPLFPEGFYNEVQVVIHVL
SVNPEIPADIPALIGASAALAVSGLPFNGPVGAARVAYIDNAYVLNPTRDQLKASSLDLV
VAGTERAVLMVESEADQLPEDVMLGAVVFGHEQMQTAIDAIHELVREGGKPEWDWQPAPK
NEALIARVTELAHGDLLAAYQLRDKQARSTKLKEVYAATSAKLEEDAQAAGTVAADKATV
GNVLFDIEAKIVRSQILNGEPRIDGRDTRTVRPIEIRTGVLPRTHGSALFTRGETQALVV
ATLGTKGDEQIIDALEGEYRERFMLHYNMPPFATGETGRVGSPKRREIGHGRLAKRALVK
CLPSADEFGYSIRVVSEITESNGSSSMASVCGGCLALMDAGVPMKAHVAGIAMGLILEGN
KFAVLTDILGDEDHLGDMDFKVAGTEQGVTALQMDIKIQGITKEIMQVALAQAKEGRMHI
LGKMTSAVSGANTQLSEFAPRMITIKINPEKIRDVIGKGGSVIRALTEETGTTIDISDDG
VVTIASTSSEGMAEAKKRIENITVEIEVGQVYEGTVLKLLDFGAIVNLLPGKDGLLHISE
IVNERVKDINDYLKEGQQVKVKVIQTDEKGRVRLSAKALLNEAAASQSDTPPQQ
Download sequence
Identical sequences B1YTR1 Q0BDC6
339670.Bamb_2291 398577.BamMC406_2170 WP_011657486.1.34573 WP_011657486.1.54386 WP_011657486.1.59090 gi|172061213|ref|YP_001808865.1| gi|115352342|ref|YP_774181.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]