SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 398577.BamMC406_2716 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  398577.BamMC406_2716
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.07e-36
Family N-terminal domain of MutM-like DNA repair proteins 0.0000248
Further Details:      
 
Domain Number 2 Region: 136-227
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.3e-25
Family Middle domain of MutM-like DNA repair proteins 0.00083
Further Details:      
 
Domain Number 3 Region: 223-274
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.14e-17
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 398577.BamMC406_2716
Sequence length 275
Comment (Burkholderia ambifaria MC40 6)
Sequence
MPELPEVEVTRRGIEPFVAGRRVERVDVRTAMLRWPVPAGLAEQLRAREVLAVERRGKYL
LFEVDAGWFIVHLGMTGTLRVLPAAGVPVAAKHDHIDWIFDEFVLRFRDPRRFGAVLWHA
REAGDVHAHPLLASLGVEPFSPAFTGALLHARTRGRTVSVKQALLAGDMVVGVGNIYASE
SLFRAGIRPTTAAGKVSLPRYERLADAVRATLADAIERGGSTLRDFVGSNGESGYFQLDC
FVYDRAGLPCRVCGTPIRQIVQGQRSTYFCPTCQR
Download sequence
Identical sequences B1T5S0 B1YN48
gi|172061757|ref|YP_001809409.1| 398577.BamMC406_2716 WP_006759023.1.16599 WP_006759023.1.54386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]