SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 398577.BamMC406_6727 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  398577.BamMC406_6727
Domain Number 1 Region: 8-104
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000188
Family Anti-sigma factor antagonist SpoIIaa 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 398577.BamMC406_6727
Sequence length 114
Comment (Burkholderia ambifaria MC40 6)
Sequence
MEIKGPNYRVWYDPANIVVSFEGILQLGGPEEYQPIAELLSKVLETNPSCFTLDTRALTI
LNASGINELYKFAIAARTHGGLRLVVRASKSIAWQAEALPNLKKFNPNVEMTYD
Download sequence
Identical sequences B1Z6Q2
398577.BamMC406_6727 WP_012367362.1.54386 gi|172064728|ref|YP_001812378.1| gi|172064728|ref|YP_001812378.1|NC_010553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]